PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0843s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 211aa    MW: 23569.6 Da    PI: 8.7116
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0843s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY93.91.2e-29131189159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK vk+ ++prsYY Ct ++C+vkk+++r ++dp +v++tYeg Hnh+
  Kalax.0843s0001.1.p 131 LDDGYKWRKYGQKAVKNCNYPRSYYHCTRHTCNVKKQIQRLSKDPGIVVTTYEGIHNHP 189
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.9E-31118189IPR003657WRKY domain
SuperFamilySSF1182904.84E-26123190IPR003657WRKY domain
PROSITE profilePS5081127.554126191IPR003657WRKY domain
SMARTSM007742.2E-32131190IPR003657WRKY domain
PfamPF031064.3E-23132189IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MEGDQWPPPL TPMINQDPSS SFLYSTNGSI PATSSMSNGL LHPLSSQMMG DPEIDWVNLL  60
SQAGCSTSSS TAANNHQDLF LPPSSSSLRL IGGEDQGRNK SLDDVRKVGR KVKKVVPPRV  120
AFHTRSQDDI LDDGYKWRKY GQKAVKNCNY PRSYYHCTRH TCNVKKQIQR LSKDPGIVVT  180
TYEGIHNHPC EQFMETLSPL LNQIQFLTKF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-24121188774Probable WRKY transcription factor 4
2lex_A8e-24121188774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444939.15e-63hypothetical protein CICLE_v10024257mg
RefseqXP_006491470.15e-63PREDICTED: probable WRKY transcription factor 43
SwissprotQ9FFS36e-53WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLV4VXQ86e-63V4VXQ8_9R
STRINGVIT_15s0046g02150.t014e-60(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.12e-52WRKY DNA-binding protein 56